Anti-EIF4E (Human) pAb (Polyclonal Antibody)
Polyclonal Antibody of 200 µl targeting EIF4E for IP, RIP, WB.
| Target | EIF4E |
|---|---|
| Product Type | Antibody |
| Application | ICC, IP, RIP, WB |
| Clonality | Polyclonal |
| Conjugate | Unlabeled |
| Immunogen | KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.) |
| Host Species | Rabbit |
| Species Reactivity | Human, Hamster, Mouse, Rat |
| Formulation | 200 μl volume of PBS containing 50% glycerol, pH 7.2. No preservative is contained. |
| Research Area | Epigenetics |
| Storage Temperature | -20°C |
| Protocols | ICC, IP, RIP, WB |
| Concentration | 1 mg/mL |
| Regulatory Statement | For Research Use Only. Not for use in diagnostic procedures. |
