Solutions for Life Science & Diagnostics

Anti-EIF4E pAb

Ordering Guide

SKUNameSizeQtyPriceAdd to Cart
RN001P Anti-EIF4E pAb 200 μL $350.00

Additional Information

Anti-EIF4E pAb Specifications

Alternative Names:eukaryotic translation initiation factor 4E, CBP; EIF4F; EIF4E1; EIF4EL1/If4e; eIF-4E; EG668879; Eif4e-ps
Clonality:Polyclonal
Clone Number:Polyclonal
Conjugate:Unlabeled
Formulation:1 mg/mL in PBS/50% glycerol, pH 7.2
Gene ID Human:1977
Gene ID Mouse:13684
Gene ID Rat:117045
Host Species:Rabbit
Immunogen:KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
Regulatory Statement:For Research Use Only. Not for use in diagnostic procedures.
Isotype:Ig (aff.)
Product Type:Primary Antibody
Shipping:4
Size:200 μL
Species Reactivities:Human,Mouse,Rat,Hamster
Status:RUO
Storage:-20
Target:EIF4E

Applications: WB,IPP,RIP

IPP:5 ug/250 uL of cell extract from 2.5 x 106
RIP:15 ug/500 uL of cell extract from 4.5 x 106
WB:1:1,000
  1. Hayman TJ, et al., Cancer Res, 72, 2362 (2012): RIP-Chip
  2. Thompson K, et al., Transl Neurosci, 1, 268 (2010): RIP-Chip

 

Product Images

Anti-EIF4E pAb