Solutions for Life Science & Diagnostics

Anti-EIF4E pAb

Ordering Guide

SKUNameSizeQtyPriceAdd to Cart
RN001P Anti-EIF4E pAb 200 µg/200 µL $350.00

Additional Information

Anti-EIF4E pAb Specifications

Alternative Names:eukaryotic translation initiation factor 4E, CBP, EIF4E1, EIF4EL1/If4e, eIF-4E, EG668879, Eif4e-ps
Clonality:Polyclonal
Clone Number:Polyclonal
Conjugate:Unlabeled
Gene ID Human:1977
Gene ID Mouse:13684
Gene ID Rat:117045
Host Species:Rabbit
Immunogen:KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
Regulatory Statement:For Research Use Only. Not for use in diagnostic procedures.
Isotype:Ig (aff.)
Product Type:Primary Antibody
Shipping:4
Size:200 µg/200 µL
Species Reactivities:Human,Mouse,Rat,Hamster
Status:RUO
Storage:-20
Target:EIF4E

Applications: WB,IPP,ICC,RIP

ICC:Can be used.
IPP:5 µg/250 µL of cell extract from 2.5 x
RIP:15 µg/500 µL of cell extract from 4.5
WB:1:1,000
  1. Thompson K et al. Acute adaptive responses of central sensorimotor neurons after spinal cord injury. Translational Neuroscience 1, 268-78 (2010) (PMID:)Application: RIP
  2. Hayman TJ et al. Translation initiation factor eIF4E is a target for tumor cell radiosensitization. Cancer Res. 72, 2362-72 (2012) (PMID:22397984)Application: RIP

 

Product Images

Anti-EIF4E pAb