Solutions for Life Science & Diagnostics

Anti-EIF4E pAb

Ordering Guide

SKUNameSizeQtyPriceAdd to Cart
RN001P Anti-EIF4E pAb 200 µg/200 µL $367.50

Additional Information

Anti-EIF4E pAb Specifications

Alternative Names:eukaryotic translation initiation factor 4E, CBP, EIF4E1, EIF4EL1/If4e, eIF-4E, EG668879, Eif4e-ps
Clone Number:Polyclonal
Gene ID Human:1977
Gene ID Mouse:13684
Gene ID Rat:117045
Host Species:Rabbit
Immunogen:KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
Regulatory Statement:For Research Use Only. Not for use in diagnostic procedures.
Isotype:Ig (aff.)
Product Type:Primary Antibody
Size:200 µg/200 µL
Species Reactivities:Human,Mouse,Rat,Hamster

Applications: WB,IPP,ICC,RIP

ICC:Can be used.
IPP:5 µg/250 µL of cell extract from 2.5 x
RIP:15 µg/500 µL of cell extract from 4.5
  1. Fukao A et al. MicroRNAs Trigger Dissociation of eIF4AI and eIF4AII from Target mRNAs in Humans. Mol Cell 56, 79-89 (2014) (PMID:25280105) Application: WB
  2. Thompson K et al. Acute adaptive responses of central sensorimotor neurons after spinal cord injury. Translational Neuroscience 1, 268-78 (2010) (PMID:) Application: RIP
  3. Hayman TJ et al. Translation initiation factor eIF4E is a target for tumor cell radiosensitization. Cancer Res. 72, 2362-72 (2012) (PMID:22397984) Application: RIP


Product Images

Anti-EIF4E pAb